PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_40783_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family MYB
Protein Properties Length: 282aa    MW: 32029.6 Da    PI: 5.2108
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_40783_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding506.8e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd  l+  ++++G  +W++ ++  g+ R++k+c++rw +yl
   Neem_40783_f_1 14 KGPWTPEEDRVLIAHIQRHGHANWRALPKQAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding53.94e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T eE+e +++++++lG++ W++Ia++++ gRt++++k+ w+++l
   Neem_40783_f_1  67 RGNFTVEEEETIIKLHEMLGNR-WSAIAARLP-GRTDNEIKNVWHTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-25564IPR009057Homeodomain-like
PROSITE profilePS5129415.983961IPR017930Myb domain
SuperFamilySSF466891.96E-3010108IPR009057Homeodomain-like
SMARTSM007171.1E-121363IPR001005SANT/Myb domain
PfamPF002492.9E-141461IPR001005SANT/Myb domain
CDDcd001677.11E-101661No hitNo description
PROSITE profilePS5129426.01262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-2665116IPR009057Homeodomain-like
SMARTSM007172.5E-1566114IPR001005SANT/Myb domain
PfamPF002497.3E-1667112IPR001005SANT/Myb domain
CDDcd001676.03E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MGRAPCCEKM GLKKGPWTPE EDRVLIAHIQ RHGHANWRAL PKQAGLLRCG KSCRLRWINY  60
LRPDIKRGNF TVEEEETIIK LHEMLGNRWS AIAARLPGRT DNEIKNVWHT HLKKRVLKQK  120
QVKNSDTEQN CNTITTSDSN ITRQSESDNS NLPTNSGSSP MSPQPSSSDL SSVTTVSLRA  180
GEINQYMDVK DEQIDSFEDF PQIDESFWTD PLSYENSSIL LSEFGAIIDE LPLQSQFSST  240
DHHQAAVEQG YDYNTKADDD SMDFWYNILL NTGGESTVSF FQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-271211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00375DAPTransfer from AT3G23250Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007035114.11e-111Myb domain protein 13, putative
SwissprotQ7XBH42e-83MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLA0A061ELW61e-111A0A061ELW6_THECC; Myb domain protein 13, putative
STRINGPOPTR_0008s16660.11e-101(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.15e-83myb domain protein 15